Open Net Zero logo

Filters

Formats:
Select...
Licenses:
Select...
Organizations:
Select...
Tags:
Select...
Shared:
Sensitivities:
Datasets
L o a d i n g
Appendices for Geothermal Exploration Artificial Intelligence ReportSource

The Geothermal Exploration Artificial Intelligence looks to use machine learning to spot geothermal identifiers from land maps. This is done to remotely detect geothermal sites for the purpose of energy uses. Such uses include enhanced geothermal system (EGS) applications, especially regarding finding locations for viable EGS sites. This submission includes the appendices and reports formerly attached to the Geothermal Exploration Artificial Intelligence Quarterly and Final Reports. The appendices below include methodologies, results, and some data regarding what was used to train the Geothermal Exploration AI. The methodology reports explain how specific anomaly detection modes were selected for use with the Geo Exploration AI. This also includes how the detection mode is useful for finding geothermal sites. Some methodology reports also include small amounts of code. Results from these reports explain the accuracy of methods used for the selected sites (Brady Desert Peak and Salton Sea). Data from these detection modes can be found in some of the reports, such as the Mineral Markers Maps, but most of the raw data is included the DOE Database which includes Brady, Desert Peak, and Salton Sea Geothermal Sites.

0
No licence known
Tags:
AIArcGisBradyCaliforniaDesert PeakEGSGISInSARMorphologicalMorphologyNevadaPythonSVMSWIRSalton SeaTIRVNIRZoteroanomaly detectionartificial intelligenceblindblind systembordercodeconceptual modeldatabasedeep learningdeformationenergyengineered geothermal systemenhanced geothermal systemexplorationfaultgeodatabasegeophysicalgeophysicsgeospatial datageothermalhydrothermalhydrothermally altered mineralshyperspectralhyperspectral imagingland surface temperaturemachine learningmineral markersmodelmorphological featurespreproccessedprocessed dataradarraw dataremote sensingseismicshort wavelength infraredsite detectionsupport vector machinethermal infraredvisible near infraredwell
Formats:
DOCXZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Archuleta County CO LineamentsSource

This layer traces apparent topographic and air-photo lineaments in the area around Pagosa springs in Archuleta County, Colorado. It was made in order to identify possible fault and fracture systems that might be conduits for geothermal fluids. Geothermal fluids commonly utilize fault and fractures in competent rocks as conduits for fluid flow. Geothermal exploration involves finding areas of high near-surface temperature gradients, along with a suitable plumbing system that can provide the necessary permeability. Geothermal power plants can sometimes be built where temperature and flow rates are high. To do this, georeferenced topographic maps and aerial photographs were utilized in an existing GIS, using ESRI ArcMap 10.0 software. The USA_Topo_Maps and World_Imagery map layers were chosen from the GIS Server at server.arcgisonline.com, using a UTM Zone 13 NAD27 projection. This line shapefile was then constructed over that which appeared to be through-going structural lineaments in both the aerial photographs and topographic layers, taking care to avoid manmade features such as roads, fence lines, and right-of-ways. These lineaments may be displaced somewhat from their actual location, due to such factors as shadow effects with low sun angles in the aerial photographs. Note: This shape file was constructed as an aid to geothermal exploration in preparation for a site visit for field checking. We make no claims as to the existence of the lineaments, their location, orientation, and nature.

0
No licence known
Tags:
ArcGISArchuleta CountyColoradoGISdataexplorationfaultflow testfracturegeospatialgeospatial datageothermalgeothermal fluidslineamentsshape fileshapefilesystems
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Brady Geodatabase for Geothermal Exploration Artificial IntelligenceSource

These files contain the geodatabases related to Brady's Geothermal Field. It includes all input and output files for the Geothermal Exploration Artificial Intelligence. Input and output files are sorted into three categories: raw data, pre-processed data, and analysis (post-processed data). In each of these categories there are six additional types of raster catalogs which are titled Radar, SWIR, Thermal, Geophysics, Geology, and Wells. These inputs and outputs were used with the Geothermal Exploration Artificial Intelligence to identify indicators of blind geothermal systems at the Brady Hot Springs Geothermal Site. The included zip file is a geodatabase to be used with ArcGIS and the tar file is an inclusive database that encompasses the inputs and outputs for the Brady Hot Springs Geothermal Site.

0
No licence known
Tags:
AIArcGISBradyBrady WellBrady hot springsGISLSTNevadaSVMSWIRanomaly detectionartificial intelligenceblindblind systemconceptual modeldatabasedeep learningdeformationenergyexplorationfaultfield datageodatabasegeophysicalgeophysicsgeospatial datageospatial databasegeothermalgeothermal site detectionhydrothermalhyperspectralhyperspectral imagingland surface temperaturemachine learningmodelpreprocessedprocessed dataradarrasterraw dataremote sensingseismicshort wavelength infraredsite detectionsupport vector machinevectorwell
Formats:
ZIPTARDOCX
National Renewable Energy Laboratory (NREL)over 1 year ago
Colorado Regional FaultsSource

This layer contains the regional faults of Colorado. The geodatabase includes show faults throughout Colorado and can be accessed with a GIS software.

0
No licence known
Tags:
ArcGISColoradoFaultsGISRegionalStructuredatafaultgeospatialgeospatial datageothermalshape fileshapefile
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Curated Modeled Fault Data SetSource

The curated fault model simulation data set consists of tagged and fully-described time series representing simulated faults for the AFDD test building (ORNLs Flexible Research Platform (FRP)), including baseline performance, faulty performance, and corresponding energy impact. A total of 26 fault models are considered for 99 simulation scenarios with various fault intensity levels. Additional Contacts: Principal investigator: Matt Leach Matt.Leach@nrel.gov Simulation performer: Janghyun Kim Janghyun.Kim@nrel.gov

0
No licence known
Tags:
AFDDEnergyPlusbuildingbuilding energybuilding energy efficiencybuildingscommercialenergy efficiencyfaultmodelsimulation
Formats:
HTMLPDFZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Curated Test Fault Data SetSource

The curated fault experiment data set consists of tagged and fully described time series representing measured faults from the AFDD test building (ORNLs Flexible Research Platform [FRP]), including baseline performance and faulty performance. A total of 10 different faults are tested for 49 different faulted and unfaulted scenarios with various fault intensity levels. Additional Contacts: Principal investigator: Matt Leach Matt.Leach@nrel.gov Experiments coordinator: Piljae Im imp1@ornl.gov Document preparation: Janghyun Kim Janghyun.Kim@nrel.gov

0
No licence known
Tags:
AFDDEnergyPlusHVACbuildingbuilding efficiencybuilding energybuilding faultsbuilding performancebuildingscommercialenergyenergy efficiencyexperimentfault
Formats:
ZIPPDFHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Desert Peak Geodatabase for Geothermal Exploration Artificial IntelligenceSource

These files contain the geodatabases related to the Desert Peak Geothermal Field. It includes all input and output files used in the project. The files include data categories of raw data, pre-processed data, and analysis (post-processed data). In each of these categories there are six additional types of raster catalogs including Radar, SWIR, Thermal, Geophysics, Geology, and Wells. The files for the Desert Peak Geothermal Site are used with the Geothermal Exploration Artificial Intelligence to identify indicators of blind geothermal systems. The included zip file is a geodatabase to be used with ArcGIS and the tar file is an inclusive database that encompasses the inputs and outputs for the Desert Peak Geothermal Field.

0
No licence known
Tags:
AIArcGISDesert PeakGISLSTNevadaSVMSWIRSupport Vector Machineanomaly detectionartificial intelligenceblindblind systemconceptual modeldatabasedeep learningdeformationenergyexplorationfaultgeodatabasegeophysicalgeophysicsgeospatial datageothermalgeothermal site detectionhydrothermalhyperspectralhyperspectral imagingland surface temperaturemachine learningmodelpreprocessedprocessed dataradarraw dataremote sensingshort wavelength infraredsite detectionwell
Formats:
ZIPTARDOCX
National Renewable Energy Laboratory (NREL)over 1 year ago
East Bend Wireline Logs

Mixed wireline logs including both cased and open hole logs. Data sets are PDS, LAS, and excel files that commonly contain multiple logs. Types of wireline logs include gamma ray, neutron porosity, photoelectric, sonic, mineral volume, ELAN, FMI, cement bond logs, magnetic resonance, and laterolog.

0
No licence known
Tags:
ELANEast BendEau ClaireFMIKentuckyMt. SimonRabbit Haskarray inductioncement bond logdensitydirectional surveydiscriminated attenuationfaultformation densityfracturegamma raylaterologmagnetic resonancemineral volumeneutron porositypermeabilityphotoelectricplatform expressporosityprecambrianresistivitytransit timevariable densityvolumewireline
Formats:
ZIP
National Energy Technology Laboratory (NETL)about 1 year ago
East Bend Wireline Logs

Mixed wireline logs including both cased and open hole logs. Data sets are PDS, LAS, and excel files that commonly contain multiple logs. Types of wireline logs include gamma ray, neutron porosity, photoelectric, sonic, mineral volume, ELAN, FMI, cement bond logs, magnetic resonance, and laterolog.

0
No licence known
Tags:
ELANEast BendEast Bend Well 1Eau ClaireFMIKentuckyMt. SimonRabbit Haskarray inductioncement bond logdensitydirectional surveydiscriminated attenuationdrillers quick lookfaultformation densityfracturegamma raylaterologmagnetic resonancemineral volumeneutron porositypermeabilityphotoelectricplatform expressporosityprecambrianresistivitytransit timevariable densityvolumewireline
Formats:
ZIP
National Energy Technology Laboratory (NETL)about 1 year ago
Effective Elastic and Neutron Capture Cross Section Calculations Corresponding to Simulated Fluid Properties from CO2 Push-Pull SimulationsSource

The submission contains a .xls files consisting of 10 excel sheets, which contain combined list of pressure, saturation, salinity, temperature profiles from the simulation of CO2 push-pull using Brady reservoir model and the corresponding effective compressional and shear velocity, bulk density, and fluid and time-lapse neutron capture cross section profiles of rock at times 0 day (baseline) through 14 days. First 9 sheets (each named after the corresponding CO2 push-pull simulation time) contains simulated pressure, saturation, temperature, salinity profiles and the corresponding effective elastic and neutron capture cross section profiles of rock matrix at the time of CO2 injection. Each sheet contains two sets of effective compressional velocity profiles of the rock, one based on Gassmann and the other based on Patchy saturation model. Effective neutron capture cross section calculations are done using a proprietary neutron cross-section simulator (SNUPAR) whereas for the thermodynamic properties of CO2 and bulk density of rock matrix filled with fluid, a standalone fluid substitution tool by Schlumberger is used. Last sheet in the file contains the bulk modulus of solid rock, which is inverted from the rock properties (porosity, sound speed etc) based on Gassmann model. Bulk modulus of solid rock in turn is used in the fluid substitution.

0
No licence known
Tags:
CO2EGSSNUPARactive seismicbrinecarbon dioxidecharacterizationenergyfaultfluidfracturegeothermalneutron capturepush-pullsensitivity analysisstimulationwell logging
Formats:
XLSX
National Renewable Energy Laboratory (NREL)over 1 year ago
Exploration Gap Assessment (FY13 Update)Source

This submission contains an update to the previous Exploration Gap Assessment funded in 2012, which identify high potential hydrothermal areas where critical data are needed (gap analysis on exploration data). The uploaded data are contained in two data files for each data category: A shape (SHP) file containing the grid, and a data file (CSV) containing the individual layers that intersected with the grid. This CSV can be joined with the map to retrieve a list of datasets that are available at any given site. A grid of the contiguous U.S. was created with 88,000 10-km by 10-km grid cells, and each cell was populated with the status of data availability corresponding to five data types: 1. well data 2. geologic maps 3. fault maps 4. geochemistry data 5. geophysical data

0
No licence known
Tags:
SGWStanford Geothermal WorkshopdBase filedata coveragedata gapsexplorationfaultfault mapsgapgap assessmentgeochemistrygeochemistry datageologicgeologic mapsgeophysicalgeospatial datageothermalgeothermal prospectorindex filemineralnational geothermal data systemngdsnrelpaperprocessprojection fileraw datashapefilestructural mapsstructurewellwell datawestern US
Formats:
dBaseCSVshxprjSHPPDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Fallon FORGE: Seismic Reflection ProfilesSource

Fourteen seismic reflection profiles and their interpretations for the southern Carson Sink within and proximal to the proposed Fallon FORGE site. Five profiles were provided by the Navy Geothermal Program Office and reprocessed by Optim Inc. Nine proflies were acquired from the Seismic Exchange Inc and have been interpreted by UNR.

0
No licence known
Tags:
Carson SinkFORGEFallonNevadaSEISeismicSeismic Profilescontactsdepth convertedfaultgeophysicsgeothermalinterpretationinterpretedinterprettednvreflectiontraces
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Fort Bliss Geothermal Area Data: Temperature Profile, Logs, Schematic Model and Cross SectionSource

This dataset contains a variety of data about the Fort Bliss geothermal area, part of the southern portion of the Tularosa Basin, New Mexico. The dataset contains schematic models for the McGregor Geothermal System, a shallow temperature survey of the Fort Bliss geothermal area. The dataset also contains Century OH logs, a full temperature profile, and complete logs from well RMI 56-5, including resistivity and porosity data, drill logs with drill rate, depth, lithology, mineralogy, fractures, temperature, pit total, gases, and descriptions among other measurements as well as CDL, CNL, DIL, GR Caliper and Temperature files. A shallow (2 meter depth) temperature survey of the Fort Bliss geothermal area with 63 data points is also included. Two cross sections through the Fort Bliss area, also included, show well position and depth. The surface map included shows faults and well spatial distribution. Inferred and observed fault distributions from gravity surveys around the Fort Bliss geothermal area.

0
No licence known
Tags:
3D56-5ArcGISCDLCNLCaliperCenturyConceptualDILDavis DomeFaultsFor BlissFort BlissGISGeoTechMapMcGregor RangeModelNew MexicoOHPorosityRMI 56-5ResistivitySchematicTularosaTularosa BasinX ray diffractionXRDboreholecross sectioncross-sectiondepthdownholedrill logdrill logsfaultfracturegammagasesgeologygeophysicsgeopysicalgeospatial datageothermalgoethermalgravitylithologymcgregormineralogypitprofileshallowshape fileshapefilespatialstratigraphysurface mapsurveytemperaturetemperature profiletemperature surveytpwell datawell depthwell locationwell logwell positionwells
Formats:
TIFXLSXZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Full Moment Tensor Inversion SoftwareSource

The link points to a website at NCEDC to download the full moment tensors inversion software The moment tensor analysis conducted in the current project is based on the full moment tensor model described in Minson and Dreger (2008). The software including source, examples and tutorial can be obtained from ftp://ncedc.org/outgoing/dreger (download file pasi-nov282012.tar.gz). Performance criteria, mathematics and test results are provided by Minson and Dreger (2008), Ford et al. (2008, 2009, 2010, 2012) and Saikia (1994). References: Ford, S., D. Dreger and W. Walter (2008). Source Characterization of the August 6, 2007 Crandall Canyon Mine Seismic Event in Central Utah, Seism. Res. Lett., 79, 637-644. Ford, S. R., D. S. Dreger and W. R. Walter (2009). Identifying isotropic events using a regional moment tensor inversion, J. Geophys. Res., 114, B01306, doi:10.1029/2008JB005743. Ford, S. R., D. S. Dreger and W. R. Walter (2010). Network sensitivity solutions for regional moment tensor inversions, Bull. Seism. Soc. Am., 100, p. 1962-1970. Ford, S. R., W. R. Walter, and D. S. Dreger (2012). Event discrimination using regional moment 665 tensors with teleseismic-P constraints, Bull. Seism. Soc. Am. 102, 867-872. Minson, S. and D. Dreger (2008), Stable Inversions for Complete Moment Tensors, Geophys. J. Int., 174, 585-592. Saikia, C.K. (1994), Modified Frequency-Wavenumber Algorithm for Regional Seismograms using Filons Quadrature: Modeling of Lg Waves in Eastern North America. Geophys. J. Int., 118, 142-158.

0
No licence known
Tags:
EGSanalysisearthquakeenergyexamplefaultfaultingfracturefull moment tensor inversiongenerationgeophysicalgeophysicsgeothermalhydraulicinducedinjectioninversionmicroseismicitymoment tensormonitoringpassiveseismicseismicitysoftwarestimulationtutorial
Formats:
HTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Geocube

Online web mapping tool for visualization and simple analysis of Earth-energy data files from public and DOE related sources. Geocube allows users to upload and visualize their own datasets but also comes preloaded with individual spatial datasets as well as spatial data collections that align to topical themes.

0
No licence known
Tags:
EarthGIScarbon storageconsumptioncustomizedownloadenergyenvironmentalfaultgasgeodatabasegeographichydrocarboninfrastructureoffshoreoilonshorepermeabilitypipelineporositypressureproductionreservoirsequestrationshapefilesubsurfacesurfacetemperaturethicknesstransmissionunconventionalvisualizationwell
Formats:
HTML
National Energy Technology Laboratory (NETL)about 1 year ago
Geothermal Exploration Raster Files for Utah Play Fairway AnalysisSource

This submission contains raster files associated with several datasets that include earthquake density, Na/K geothermometers, fault density, heat flow, and gravity. Integrated together using spatial modeler tools in ArcGIS, these files can be used for play fairway analysis in regard to geothermal exploration.

0
No licence known
Tags:
PFAcharacterizationearthquakeeasterneastern great basinenergyexplorationfaultfault systemsgeophysicsgeospatialgeospatial datageothermalgeothermometergravitygreat basinheatheat flowplay fairway analysisrastersevierspatialutahwestern
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Live Power Cuts

You can see a live-map of all power cuts and problems in the National Grid Electricity Distribution area [here](https://powercuts.nationalgrid.co.uk/). You can call 105 to report or get information about power cuts in your local area. You can also call 105 if you spot damage to electricity power lines and substations that could put you, or someone else, in danger. If there’s a serious immediate risk, you should call the emergency services too. In this dataset you can see a live view of all power cuts and incidents in the National Grid Electricity Distribution area.

0
nged-open-data
Tags:
Power cutfaultinterruptionoutage
Formats:
CSV
National Grid Electricity Distribution4 months ago
Material Properties for Brady Hot Springs Nevada USA from PoroTomo ProjectSource

The PoroTomo team has completed inverse modeling of the three data sets (seismology, geodesy, and hydrology) individually, as described previously. The estimated values of the material properties are registered on a three-dimensional grid with a spacing of 25 meters between nodes. The material properties are listed an Excel file. Figures show planar slices in three sets: horizontal slices in a planes normal to the vertical Z axis (Z normal), vertical slices in planes perpendicular to the dominant strike of the fault system (X normal), and vertical slices in planes parallel to the dominant strike of the fault system (Y normal). The results agree on the following points. The material is unconsolidated and/or fractured, especially in the shallow layers. The structural trends follow the fault system in strike and dip. The geodetic measurements favor the hypothesis of thermal contraction. Temporal changes in pressure, subsidence rate, and seismic amplitude are associated with changes in pumping rates during the four stages of the deployment in 2016. The modeled hydraulic conductivity is high in fault damage zones. All the observations are consistent with the conceptual model: highly permeable conduits along faults channel fluids from shallow aquifers to the deep geothermal reservoir tapped by the production wells.

0
No licence known
Tags:
3DBrady Hot SpringsNevadaPoissons ratioYoungs modulusconceptualconduitdensitydipenergyfaultfluidfracturedgeodesygeologygeothermalhydraulic conductivityhydrologyinterferometryinversionlithologymaterialmodelmodelingp-wavepermeableporoelastic tomographyporotomopressurepropertiespropertypumpingratereservoirs-waveseismicseismic amplitudeseismologyshallowstrain ratestrikestructuralsubsidencetemperaturethermal contractiontrendsunconsolidatedvelocityzone
Formats:
matXLSXCSVZIPPDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Oregon Cascades Play Fairway Analysis: Faults and Heat Flow MapsSource

This submission includes a fault map of the Oregon Cascades and backarc, a probability map of heat flow, and a fault density probability layer. More extensive metadata can be found within each zip file. For information about "Oregon Faults," contact John David Trimble, Oregon State University. trimbljo@onid.oregonstate.edu

0
No licence known
Tags:
cascadescomposite risk segmentcrsdensityfaultfault densityfaultsfeaturesflowgeologygeospatial datageothermalheatheat flowheatflowkrigingmaporegonoregon state universitypfaplay fairway analysisprobabilitystructural
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Oregon Cascades Play Fairway Analysis: MapsSource

The maps in this submission include: heat flow, alkalinity, Cl, Mg, SiO2, Quaternary volcanic rocks, faults, and land ownership. All of the Oregon Cascade region. The work was done by John Trimble, in 2015, at Oregon State University.

0
No licence known
Tags:
ChlorideClConcentrationFaultsFelsicMaficMagnesiumMgQuaternarySiO2SilicaVolcanicsalkalinitycascadesfaultflowgeochemistrygeothermalheatheatflowhotkriginglandlocationsmaporegonownershipsamplesilicatesprings
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Play Fairway Analysis CA-NV-OR: 2km Grid Based AnalysisSource

Combined geochemical and geophysical data, weighted and ranked for geothermal prospect favorability.

0
No licence known
Tags:
CA-NV-ORCaliforniaMTMedicine LakeNevadaOregonPFASan Emidiocharacterizationexplorationfaultfaultsfavorabilitygeochemistrygeophysicsgeothermalgeothermometrygrid filesheat flowheliumplay fairway anaysisprospectrankrankingsseismicitystrainstrain ratestressstructural settingvolcanismwell data
Formats:
XLSX
National Renewable Energy Laboratory (NREL)over 1 year ago
Processed Lab Data for Neural Network-Based Shear Stress Level PredictionSource

Machine learning can be used to predict fault properties such as shear stress, friction, and time to failure using continuous records of fault zone acoustic emissions. The files are extracted features and labels from lab data (experiment p4679). The features are extracted with a non-overlapping window from the original acoustic data. The first column is the time of the window. The second and third columns are the mean and the variance of the acoustic data in this window, respectively. The 4th-11th column is the the power spectrum density ranging from low to high frequency. And the last column is the corresponding label (shear stress level). The name of the file means which driving velocity the sequence is generated from. Data were generated from laboratory friction experiments conducted with a biaxial shear apparatus. Experiments were conducted in the double direct shear configuration in which two fault zones are sheared between three rigid forcing blocks. Our samples consisted of two 5-mm-thick layers of simulated fault gouge with a nominal contact area of 10 by 10 cm^2. Gouge material consisted of soda-lime glass beads with initial particle size between 105 and 149 micrometers. Prior to shearing, we impose a constant fault normal stress of 2 MPa using a servo-controlled load-feedback mechanism and allow the sample to compact. Once the sample has reached a constant layer thickness, the central block is driven down at constant rate of 10 micrometers per second. In tandem, we collect an AE signal continuously at 4 MHz from a piezoceramic sensor embedded in a steel forcing block about 22 mm from the gouge layer The data from this experiment can be used with the deep learning algorithm to train it for future fault property prediction.

0
No licence known
Tags:
Biaxial Shear ExperimentMATLABacoustic emissionsacousticsaiartificial intelligencebiaxial shear apparatuscodedeep learningenergyexperimentexperimental datafaultfault propertiesfrictiongeophysicsgeothermallab datamachine learningmicroseismicityprocessed dataseismicseismic forcastingseismic predictionshear stresstime to failure
Formats:
mat
National Renewable Energy Laboratory (NREL)over 1 year ago
SE Great Basin Play Fairway Analysis Heat and Permeability CRSSource

Within this submission are multiple .tif images with accompanying metadata of magnetotelluric conductor occurrence, fault critical stress composite risk segment (CRS), permeability CRS, Quaternary mafic extrusions, Quaternary fault density, and Quaternary rhyolite maps. Each of these contributed to a final play fairway analysis (PFA) for the SE Great Basin study area.

0
No licence known
Tags:
EasternGreat BasinMTSE great basinUtahbasaltcomposite risk segmentconductorcritical stresscrsdataeastern great basinexplorationfaultfault densityfaultsfluid flowgeospatial datageothermallineamentsmagnetotelluricmapoccurencepermeabilitypfaplay fairway analysisprobabilityquaternaryquaternary faultsrhyolite
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development - Deviatoric MT, Fracture Network, and Final ReportSource

This submission contains 167 deviatoric moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration. Also included is a statistical representation of the properties of 751 fractures derived from the analysis of seismicity observed two years prior and three years post start of injection activities at The Geysers Prati 32 EGS Demonstration Project. The locations of the fractures are taken from microseismic hypocenters, the fracture areas are derived from moment magnitudes via scaling relationships, and the azimuths (sigma 1) and dips (sigma 3) are derived from the results of stress analyses.

0
No licence known
Tags:
CACaliforniaDeviatoric MT SolutionsEGSGeysersHigh Temperature ReservoirThe Geysersanalysiscatalogdeviatoricearthquakeenergyeventfaultfaultingfinal reportfracturefracture networkfracture orientationfracture sizegeophysicalgeophysicsgeothermalhydraulichypocentersinducedinjectioninversionlocationmicroseismicmicroseismicitymomentmonitoringnetworkpassiveseismicseismicityshearstimulationstrainstresstensor
Formats:
CSVXLSXHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Seismic Analysis of Spatio-Temporal Fracture Generation During EGS Resource Development - Full Moment Tensors and Stress Inversion CatalogsSource

This submission contains 167 full moment tensor (MT) solutions for the seismicity observed two years prior and three years post start of injection activities. Also included are the azimuth and plunge angles for the three main stress directions sigma1, sigma 2 and sigma 3 at the Prati32 EGS demonstration site in the northwest Geysers geothermal reservoir. The data are divided into 15 time periods spanning a range of five years, including two years prior to start of injection until three years post start of injection activities.

0
No licence known
Tags:
EGSHigh Temperature ReservoirPrati 32Spatio-TemporalThe Geysersanalysisarrayazimuthcatalogdemonstrationdevelopmentearthquakeenergyenhanced geothermalfaultfaultingfracturefull MTgenerationgeophysicalgeophysicsgeothermalgeysershydraulicinducedinjectioninversionmicroseismicitymincroseismicitymomentmonitoringpassiveplungereservoirresourceseismicseismic moment tensorseismicitysolutionsstimulationstressstress changesstress orientationtensor
Formats:
XLSX
National Renewable Energy Laboratory (NREL)over 1 year ago
Shallow (2-meter) Temperature Surveys in ColoradoSource

Shallow temperature surveys are useful in early-stage geothermal exploration to delineate surface outflow zones, with the intent to identify the source of upwelling, usually a fault. Detailed descriptions of the 2-meter survey method and equipment design can be found in Coolbaugh et al. (2007) and Sladek et al. (2007), and are summarized here. The survey method was devised to measure temperature as far below the zone of solar influence as possible, have minimal equilibration time, and yet be portable enough to fit on the back of an all-terrain vehicle (ATV); Figure 2). This method utilizes a direct push technology (DPT) technique where 2.3 m long, 0.54" outer diameter hollow steel rods are pounded into the ground using a demolition hammer. Resistance temperature devices (RTD) are then inserted into the rods at 2-meter depths, and allowed to equilibrate for one hour. The temperatures are then measured and recorded, the rods pulled out of the ground, and re-used at future sites. Usually multiple rods are planted over the course of an hour, and then the sampler returns back to the first station, measures the temperatures, pulls the rods, and so on, to eliminate waiting time. At Wagon Wheel Gap, 32 rods were planted around the hot springs between June 20 and July 1, 2012. The purpose was to determine the direction of a possible upflow fault or other structure. Temperatures at 1.5m and 2m depths were measured and recorded in the attribute table of this point shapefile. Several anomalous temperatures suggest that outflow is coming from a ~N60W striking fault or shear zone that contains the quartz-fluorite-barite veins of the adjacent patented mining claims. It should be noted that temperatures at 2m depth vary according to the amount of solar heating from above, as well as possible geothermal heating from below.

0
No licence known
Tags:
ArcGISColoradoGISShallow temperature surveyanomaly detectiondataexplorationfaultfault detectiongeospatialgeospatial datageothermalremote sensingshallow temperature surveysshape fileshapefiletemperatureupflow fault
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Simulations of Brady's-Type Fault Undergoing CO2 Push-Pull: Pressure-Transient and Sensitivity AnalysisSource

Input and output files used for fault characterization through numerical simulation using iTOUGH2. The synthetic data for the push period are generated by running a forward simulation (input parameters are provided in iTOUGH2 Brady GF6 Input Parameters.txt [InvExt6i.txt]). In general, the permeability of the fault gouge, damage zone, and matrix are assumed to be unknown. The input and output files are for the inversion scenario where only pressure transients are available at the monitoring well located 200 m above the injection well and only the fault gouge permeability is estimated. The input files are named InvExt6i, INPUT.tpl, FOFT.ins, CO2TAB, and the output files are InvExt6i.out, pest.fof, and pest.sav (names below are display names). The table graphic in the data files below summarizes the inversion results, and indicates the fault gouge permeability can be estimated even if imperfect guesses are used for matrix and damage zone permeabilities, and permeability anisotropy is not taken into account.

0
No licence known
Tags:
BradyCO2EGSGF6INCONPESTTOUGH2carbon dioxidecharacterizationenergyfaultfault modelingfaultingfracturegeothermaliTOUGH2inverse modelingparameter estimationpressure-transient testingpush-pullsensitivity analysisstimulation
Formats:
DOCXinsoutfoftplsavJPEGTXTHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Snake River Plain Geothermal Play Fairway Analysis - Volcanic Vents, Lacustrine Sediments, and post-Miocene Faults KMZ filesSource

This dataset contain raw data files in kmz files (Google Earth georeference format). These files include volcanic vent locations and age, the distribution of fine-grained lacustrine sediments (which act as both a seal and an insulating layer for hydrothermal fluids), and post-Miocene faults compiled from the Idaho Geological Survey, the USGS Quaternary Fault database, and unpublished mapping. It also contains the Composite Common Risk Segment Map created during Phase 1 studies, as well as a file with locations of select deep wells used to interrogate the subsurface.

0
No licence known
Tags:
CCRSIdahoPFAPlay Fairway AnalysisSRPSnake River Plaindatafaultfaultsgeoreferencinggeospatialgeospatial datageothermalgoogle earthkmzlacustrinemudsphase 1sedimentsedimentsstructureventventsvolcanicvolcanics
Formats:
KMZ
National Renewable Energy Laboratory (NREL)over 1 year ago
Tularosa Basin Play Fairway Analysis: Partial Basin and Range Heat and Zones of Critical Stress MapsSource

Interpolated maps of heat flow, temperature gradient, and quartz geothermometers are included as TIF files. Zones of critical stress map is also included as a TIF file. The zones are given a 5km diameter buffer. The study area is only a part of the Basin and Range, but it does includes the Tularosa Basin.

0
No licence known
Tags:
Basin and RangeGreat BasinNevadaQuartzUtahcritical stressextrapolationfaultfort blissgeospatial datageothermalgeothermometergeothermometrygradientheat flowheatflowinterpolationmapmapsnew mexicopermeabilitypfaplay fairway analysisquartz geothermometertemperaturetemperature gradienttularosatularosa basinzones
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Utah FORGE Induced Seismicity Mitigation PlanSource

This is the current induced seismicity mitigation plan (ISMP) for the Utah FORGE project. Information that was collected during Phases 1 and 2 of the Utah FORGE project has been incorporated, as have literature searches and risk assessments. The purpose of this report is to identify and mitigate induced seismicity for the Utah FORGE Project. Mitigation includes preliminary screening, outreach, criteria for ground vibration and noise, data collection practices, and natural seismic hazard analysis. From this, the overall risk from the project was determined. This report is subject to change as new information comes to light.

0
No licence known
Tags:
EGSMitigation planUtahUtah FORGEearthquakeearthquakesenergyfaultfaultsgeophysicsgeothermalhazardinduced seismicityinduced seismicity mitigation planmitigationplanriskrisk mitigationseismicseismicityseismicity mitigation
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Utah FORGE: Faults, Fractures, and Lineaments in the Mineral MountainsSource

This submission includes a shapefile of the Opal Mound Fault, and multiple datasets of lineaments mapped in the Mineral Mountains which overlook the Utah FORGE site, hyperlinked to rose diagrams in a polygon grid shapefile.

0
No licence known
Tags:
ArcGISFORGELineamentMilfordOpal MoundRoosevelt Hot SpringsShapefileUtahUtah FORGEegsfaultfaultsfracturefracturesgeologygeospatial datageothermaljointlineamentsmineral mountainsmoundopalrose diagramshape filestructural
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Utah FORGE: Nevada Crustal StrainSource

An estimate of the total magnitude of crustal strain in Nevada (2nd invariant of the strain rate), independent of fault orientation. Crustal strain based on GPS station measurements. Nevada Bureau of Mines and Geology.

0
No licence known
Tags:
EGSFORGEGPSGreat Basin strainNevadaUtahUtah FORGEcrustalfaultgeodesygeodeticgeothermalmagnitudeorientationratesecond invariantstraintensor
Formats:
ZIP4111&rep=rep1&type=pdf
National Renewable Energy Laboratory (NREL)over 1 year ago
Washington Play Fairway Analysis - Poly 3D Matlab Fault Modeling Scripts with Input Data to Create Permeability Potential ModelsSource

Matlab scripts and functions and data used to build Poly3D models and create permeability potential GIS layers for 1) Mount St. Helens seismic zone, 2) Wind River Valley, and 3) Mount Baker geothermal prospect areas located in Washington state.

0
No licence known
Tags:
100k geologic fault mapping24k geologic fault mappingCascade RangeLOWESSMatlabMount BakerMount St. Helens seismic zoneMt BakerPoly3DWashingtonWashington StateWind River Valleycodedilation tencencydilation tendencydisplacementdisplacement gradientexplorationfaultfault modelfavorabilityfeaturesgeologygeothermalmaximum Coulomb shear stressmicro-seismicitymodelmodelingpermeabilitypermeability potentialpfaplay fairwayprospectscriptsensitivitysigma 3slip tendencystress modelstructuraluncertainty
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Washington Play Fairway Analysis Geothermal Heat and Permeability Potential GeodatabasesSource

This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeling and interpolation) from the geothermal play-fairway in Washington State, USA. These data were gathered and modeled to provide an estimate of the heat and permeability potential within the play-fairways based on: mapped volcanic vents, hot springs and fumaroles, geothermometry, intrusive rocks, temperature-gradient wells, slip tendency, dilation tendency, displacement, displacement gradient, max coulomb shear stress, sigma 3, maximum shear strain rate, and dilational strain rate at 200m and 3 km depth. In addition this file contains layer files for each of the output rasters. For details on the areas of interest please see the 'Phase 1 Technical Report' in the download package. This submission also includes a file with the geothermal favorability of the Washington Cascade Range based off of an earlier statewide assessment. Additionally, within this file there are the maximum shear and dilational strain rate rasters for all of Washington State.

0
No licence known
Tags:
ArcGISCascade RangeGISGeothermal favorabilityMount BakerMount St. Helens seismic zoneSlip tendencyStrain rateWashingtonWind River valleydilation tendencydilational strain ratedisplacementdisplacement gradientfaultfavorabilityfumarolegdbgeodatabasegeospatial datageothermalgeothermometryheathot springintrusive rockmaximum Coulomb shear stressmaximum shear strain ratepermeabilitypfaplay-fairwayrisksensitivitysigma 3temeprature gradientuncertaintyvolcanic ventwashington state
Formats:
ZIPPDF
National Renewable Energy Laboratory (NREL)over 1 year ago
West Flank Coso FORGE: ArcGIS Data for Geologic ModelSource

Archive of ArcGIS data from the West Flank FORGE site located in Coso, California. Archive contains the following eight shapefiles: Polygon of the 3D geologic model (WestFlank3DGeologicModelExtent) Polylines of the traces 3D modeled faults (WestFlank3DModeledFaultTraces) Polylines of the fault traces from Duffield and Bacon, 1980 (WestFlankFaultsfromDuffieldandBacon) Polygon of the West Flank FORGE site (WestFlankFORGEsite) Polylines of the traces of the geologic cross-sections (cross-sections in a separate archive in the GDR) (WestFlankGeologicCrossSections) Polylines of the traces of the seismic reflection profiles through and adjacent to the West Flank site (seismic reflection profiles in a separate archive in the GDR) (WestFlankSiesmicReflectionProfiles) Points of the well collars in and around the West Flank site (WestFlankWellCollars) Polylines of the surface expression of the West Flank well paths (WestFlankWellPaths)

0
No licence known
Tags:
ArcGIS dataCaliforniaCosoEGSFORGEWest Flankcross-sectionfaultfault tracegeologicgeologygeospatial datageothermalmodelseismic reflectiontracewell collarwell collarswell pathwell paths
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
West Virginia Fault Shapefile provided by the WV Department of Environmental Protection (DEP)

• This link provides the digitized version of datasets from the 1968 State Geologic Map of West Virginia • Provides data on rock types, folds, faults, and igneous

0
No licence known
Tags:
1968FaultsFoldFoldsGeologyIgneousLithologyStructuralWest Virginiafaultgeologic maprock types
Formats:
HTML
National Energy Technology Laboratory (NETL)about 1 year ago