Open Net Zero logo

Filters

Formats:
Select...
Licenses:
Select...
Organizations:
Select...
Tags:
Select...
Shared:
Sensitivities:
Datasets
L o a d i n g
Combined Heat and Power (CHP) Project Profiles DatabaseSource

Combined heat and power (CHP)—sometimes referred to as cogeneration—provides a cost-effective, near-term opportunity to improve our nation's energy, environmental, and economic future. CHP is an efficient and clean approach to generating on-site electric power and useful thermal energy from a single fuel source. The Combined Heat and Power (CHP) Technical Potential in the United States market analysis report provides data on the technical potential in industrial facilities and commercial buildings for “topping cycle” CHP, waste heat to power CHP (WHP CHP), and district energy CHP in the U.S. Data are provided nationally by CHP system size range, facility type, and state. Each state’s technical potential is shown in detail on state profile pages that include break-downs by size range and facility type. The CHP Deployment Program provides stakeholders with the resources necessary to identify CHP market opportunities and support implementation of CHP systems. The DOE database of CHP installations provides information about CHP systems currently operating in the United States including locations, organizations served, and facility characteristics. Features include search and filter options and the ability to download a list of operating CHP systems and national-level summary tables. More than 120 CHP Project Profiles compiled by the CHP TAPs can be searched by state, CHP TAP, market sector, North American Industry Classification System (NAICS) code, system size, technology/prime mover, fuel, thermal energy use, and year installed. The Combined Heat and Power (CHP) for Resiliency Accelerator supports consideration of CHP and other distributed generation solutions for critical infrastructure resiliency planning at the state, local, and utility levels. As a collaborative effort with stakeholders, the Accelerator is developing tools, templates, and other resources to promote deployment of CHP at critical infrastructure facilities. Internet Archive URL: https://web.archive.org/web/2018*/https://www1.eere.energy.gov/manufacturing/distributedenergy/chp_database/

0
Other (Public Domain)
Tags:
Combined heat and powerDOEDepartment of EnergyNorth Americacogenerationelectric powerenergyfuelheatinfrastructurepowerthermal energyutilities
Formats:
ZIPJSONTXTHTMLPDFJPEGapplication/javascripttext/cssGIFtext/x-python
United States Department of Energyover 1 year ago
Deep Direct-Use Feasibility Study Economic Analysis using GEOPHIRES for West Virginia UniversitySource

This dataset contains all the inputs used and output produced from the modified GEOPHIRES for the economic analysis of base case hybrid GDHC system, improved hybrid GDHC system with heat pump and for hot water GDHC. Software required: Microsoft Notepad, Microsoft Excel and GEOPHIRES modified source code

0
No licence known
Tags:
DDUDHSGDHCGEOPHIRESHybrid Geothermal natural ags systemLCOHWVUcostdeep direct usedirect-usedistrict heatingdistrict heating and coolingeconomicenergyfeasibilitygeothermalheatheat pumphot waterhybridhybrid geothermal natural gas systemlevelizednatural gasreservoir simulationuncertainty analysis
Formats:
DOCXXLSXpyZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Energy Use: Generation of heat from renewable sourcesSource

Office for National Statistics Dataset of generation of heat from renewable sources shows the UK's energy use from renewable sources used to generate heat (active solar heating, heat pumps, geothermal aquifers), 1990 to 2020

0
UK Open Government Licence (OGL)
Tags:
UKgenerationgeothermalheatheatpumprenewablesolar
Formats:
XLSX
Office for National Statistics (ONS)over 1 year ago
Fallon FORGE: Well Data, Geophysical Data, and Geologic MapsSource

The data is associated to the Fallon FORGE project and includes mudlogs for all wells used to characterize the subsurface, as wells as gravity, magnetotelluric, earthquake seismicity, and temperature data from the Navy GPO and Ormat. Also included are geologic maps from the USGS and Nevada Bureau of Mines and Geology for the Fallon, NV area.

0
No licence known
Tags:
13-3614-117-1634-3335A-1147A-1151A-2056A-1458A-961-3662-1578-3682-3684-3186-1586-2586A-1588-24Basin and RangeBell and House 2010Bell et. al. 2010Carson SinkDEMEGSFOH 3FOH-3FORGEFallonFlow testGammaGeologic MapHeat FlowHighwaysHinz et. al. 2011MTMagnetotelluricMaurer and Welch 2001MudlogNDOTNVNavy GPONeadaNevadaPressureRadiogenic Heat MeasurementsSeismicSemblanceStewart and Carlson 1978TemperatureTemperature GradientWellacoustilogboreholeboundarycharacterizationdatadrillingdroearthquakesexplorationgamma raygeologicgeologygeophysicsgeospatial datageothermalgravityheatleasemapmud logradiogenicseismicitysitesubsurfacesurveywell datawell drillingx-multipole array
Formats:
PDFtiflpkHTMLphp?state=NVmpkXLSCSVXLSXZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
GEO3D - Three-Dimensional Computer Model of a Ground Source Heat Pump SystemSource

This file is the setup file for GEO3D, a computer program written by Jim Menart to simulate vertical wells in conjunction with a heat pump for ground source heat pump (GSHP) systems. This is a very detailed three-dimensional computer model. This program produces detailed heat transfer and temperature field information for a vertical GSHP system.

0
No licence known
Tags:
3D3D modelGEO3DGSHPcodecomputer modelcomputer programgeothermalground source heat pump computer programground source heat pump systemsheatheat pumpheat pumpsprogramthree dimensionaltransfervertical GSHP systemvertical geothermal well
Formats:
EXEHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Geothermal Exploration Raster Files for Utah Play Fairway AnalysisSource

This submission contains raster files associated with several datasets that include earthquake density, Na/K geothermometers, fault density, heat flow, and gravity. Integrated together using spatial modeler tools in ArcGIS, these files can be used for play fairway analysis in regard to geothermal exploration.

0
No licence known
Tags:
PFAcharacterizationearthquakeeasterneastern great basinenergyexplorationfaultfault systemsgeophysicsgeospatialgeospatial datageothermalgeothermometergravitygreat basinheatheat flowplay fairway analysisrastersevierspatialutahwestern
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Heat Stress Index (Map Service)Source

Date of freeze for historical (1985-2005) and future (2071-2090, RCP 8.5) time periods, and absolute change between them, based on analysis of MACAv2METDATA. Average historical temperature change, between 1948-1968 and 1996-2016 averages, in Celsius. Calculated using averages of minimum and maximum monthly values during these time periods. Values are based on TopoWx data. Download this data or get more information

0
No licence known
Tags:
OSCOffice of Sustainability and ClimateOpen DataUSDA Forest ServiceUSFScattleclimatedroughtextreme weatherheatrangelands
Formats:
HTMLArcGIS GeoServices REST API
United States Department of Agriculture10 months ago
HotspotsSource

Hotspots identified in the Maitland local government area

0
No licence known
Tags:
heathotspottemperature
Formats:
JSONCSVGeoJSONshp zip
Maitland City Councilover 1 year ago
INGENIOUS Thermal Conductivity Measurement Source CategorizationSource

Thermal conductivity (TC) data taken for different wells at a specified drill depth. This is an abridged version of the complete SMU heat flow database, downloaded from the SMU node of the NGDS at the beginning of INGENIOUS (approximately April 2021), and filtered to the INGENIOUS study area. This National Geothermal Data System (NGDS) project aggregates geothermal data collected and curated by the SMU Geothermal Laboratory and its partner organizations. All columns in this database are the same as the SMU database, except for 2 additions associated with this project. Repeated columns are for data correlation purposes. Column descriptions and data types are the same as previous iterations of the SMU database. The new values that are the addition are two new columns developed as part of the INGENIOUS project: INGENIOUS TC Value | INGENIOUS notes INGENIOUS notes are individual notes that were written for specific data points during the analysis process. There are not always notes associated with each input value. INGENIOUS TC Value includes 4 values: 1. Assumed Measured These are values that are assumed to be measured thermal conductivity values, either within a specific well or within the same study region. Many of these have either a published reference, a reported standard deviation, or a unique thermal conductivity value. 2. Data release - assumed measured These are values in the SMU database that are from proprietary data that were added to the SMU database and are labeled as data release for their reference. These values were searched for in person at the SMU Geothermal Laboratory as well as virtual examination of data available on the NGDS. For many of these, there are reported thermal conductivity values associated with the heat flow data in the database, but no specific table or reference to measurements in the original data release files. 3. Known measured These are values that have a reported measurement, either as an original file in the SMU data files on the NGDS or a reported table in a publication. In the rare circumstances, Maria Richards or David Blackwell confirmed measurement. Confirmation of measurement would be written in the INGENIOUS notes column. 4. Unmeasured Unmeasured values are those that are known to be unmeasured, either estimated from another report or no information given. In the SMU database, there are wells that have a heat flow but no thermal conductivity. These are categorized as unmeasured. There are also heat flow values that are stated to have estimated or generalized average thermal conductivity values for the region and rock type. Because these are known to be unmeasured, they are categorized as such. 5. Blank Blank values are either A quality or X quality. These quality values are stated in the INGENIOUS notes. These values were not going to change associated with the heat flow analysis, so these were not examined.

0
No licence known
Tags:
INGENIOUSNGDSNevadaSMUTCconductivitydatadatabasedrillingenergygeothermalheatheat flowmeasurmentnotesporosityraw datatestthermalthermal conductivitywell
Formats:
XLSX
National Renewable Energy Laboratory (NREL)over 1 year ago
IRENA Statistics DataSource

IRENA publishes detailed statistics on renewable energy capacity, power generation and renewable energy balances. This data is collected directly from members using the IRENA Renewable Energy Statistics questionnaire and is also supplemented by desk research where official statistics are not available. Renewable power-generation capacity statistics are released annually in March. Additionally, renewable power generation and renewable energy balances data sets are released in July.

0
License not specified
Tags:
Energyheatpolicypowerrenewable
Formats:
HTML
International Renewable Energy Agency (IRENA)about 1 year ago
Innovative Play Fairway Modelling Applied to the Tularosa Basin Project ReportSource

This report describes all of the work done in Phase I of a geothermal exploration project in the Tularosa Basin, as well as an outline for Phase II work, and more.

0
No licence known
Tags:
assessmentbasinexplorationfracture permeabilitygeothermalgroundwaterheatinnovativeinvestigationmodellingnew mexiconmpaperpfaphase 1play fairway analysisprojectreportresourcetularosatularosa basin
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Maitland Suburb level Heat IslandSource

Baseline dataset to understand summer-time heat distribution across the Local Government Area (LGA) and to determine where a surface heat islands may exist in the urban zone.Maitland City Council has undertaken this urban heat mapping project to identify priority suburbs within the LGA and inform targeted initiatives to mitigate the heat island effect.

0
No licence known
Tags:
heatheat islandtemperature
Formats:
https://www.iana.org/assignments/media-types/text/csvhttps://www.iana.org/assignments/media-types/application/jsonhttps://www.iana.org/assignments/media-types/application/octet-streamhttps://www.iana.org/assignments/media-types/application/gpx+xmlhttps://www.iana.org/assignments/media-types/application/vnd.google-earth.kml+xmlhttps://www.iana.org/assignments/media-types/text/plainhttps://www.iana.org/assignments/media-types/application/parquethttps://www.iana.org/assignments/media-types/application/rdf+xmlhttps://www.iana.org/assignments/media-types/application/ld+jsonhttps://www.iana.org/assignments/media-types/text/turtlehttps://www.iana.org/assignments/media-types/text/n3https://www.iana.org/assignments/media-types/application/ziphttps://www.iana.org/assignments/media-types/application/vnd.openxmlformats-officedocument.spreadsheetml.sheet
Maitland City Council5 months ago
Maitland Suburb level Heat IslandSource

Baseline dataset to understand summer-time heat distribution across the Local Government Area (LGA) and to determine where a surface heat islands may exist in the urban zone.Maitland City Council has undertaken this urban heat mapping project to identify priority suburbs within the LGA and inform targeted initiatives to mitigate the heat island effect.

0
No licence known
Tags:
heatheat islandtemperature
Formats:
JSONCSVGeoJSONshp zip
Maitland City Councilover 1 year ago
Maitland Temperature HotspotsSource

Areas in the Maitland local government area identified as temperature hotspots.

0
No licence known
Tags:
heathotspottemperature
Formats:
https://www.iana.org/assignments/media-types/text/csvhttps://www.iana.org/assignments/media-types/application/jsonhttps://www.iana.org/assignments/media-types/application/octet-streamhttps://www.iana.org/assignments/media-types/application/gpx+xmlhttps://www.iana.org/assignments/media-types/application/vnd.google-earth.kml+xmlhttps://www.iana.org/assignments/media-types/text/plainhttps://www.iana.org/assignments/media-types/application/parquethttps://www.iana.org/assignments/media-types/application/rdf+xmlhttps://www.iana.org/assignments/media-types/application/ld+jsonhttps://www.iana.org/assignments/media-types/text/turtlehttps://www.iana.org/assignments/media-types/text/n3https://www.iana.org/assignments/media-types/application/ziphttps://www.iana.org/assignments/media-types/application/vnd.openxmlformats-officedocument.spreadsheetml.sheet
Maitland City Council5 months ago
Maps, Models and Data from Southeastern Great Basin PFASource

This submission includes composite risk segment models in raster format for permeability, heat of the earth, and MT, as well as the final PFA model of geothermal exploration risk in Southwestern Utah, USA. Additionally, this submission has data regarding hydrothermally altered areas, and opal sinter deposits in the study area. All of this information lends to the understanding and exploration for hidden geothermal systems in the area.

0
No licence known
Tags:
ArcGISGBGISPhase 2SE Great BasinSEGBblind geothermal systemseasterneastern great basinenergyexplorationgeophysicsgeospatial datageothermalgreat basinheatheat flowhidden geothermal systemshydrothermalhydrothermal alterationmagnetotelluricmilfordmtopalpermeabilitypfaplay fairway analysisshape fileshapefilesinterutahx-ray diffractionxrd
Formats:
ZIPXLSX
National Renewable Energy Laboratory (NREL)over 1 year ago
New Mexico Play Fairway Analysis: Gamma Ray Logs and Heat Generation Calculations for SW New MexicoSource

For the New Mexico Play fairway Analysis project, gamma ray geophysical well logs from oil wells penetrating the Proterozoic basement in southwestern New Mexico were digitized. Only the portion of the log in the basement was digitized. The gamma ray logs are converted to heat production using the equation (Bucker and Rybach, 1996) : A[microW/m3] = 0.0158 (Gamma Ray [API] - 0.8).

0
No licence known
Tags:
NMNew MexicoPFAboreboreholedownholeexplorationgamma logsgamma raygamma ray logsgenerationgeophysicalgeophysicsgeothermalheatheat generationoil wellssouthwestsouthwestern New Mexicowell data
Formats:
XLSaspx
National Renewable Energy Laboratory (NREL)over 1 year ago
New Mexico Play Fairway Analysis: Heat FlowSource

This is an updated and simplified version of the New Mexico heat flow data already on the NGDS that was used for Play Fairway analysis.

0
No licence known
Tags:
NMNew MexicoPFAexplorationflowgeothermalheatheat flowplay fairway analysissimplifiedupdate
Formats:
XLS
National Renewable Energy Laboratory (NREL)over 1 year ago
Oregon Cascades Play Fairway Analysis: Faults and Heat Flow MapsSource

This submission includes a fault map of the Oregon Cascades and backarc, a probability map of heat flow, and a fault density probability layer. More extensive metadata can be found within each zip file. For information about "Oregon Faults," contact John David Trimble, Oregon State University. trimbljo@onid.oregonstate.edu

0
No licence known
Tags:
cascadescomposite risk segmentcrsdensityfaultfault densityfaultsfeaturesflowgeologygeospatial datageothermalheatheat flowheatflowkrigingmaporegonoregon state universitypfaplay fairway analysisprobabilitystructural
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Oregon Cascades Play Fairway Analysis: MapsSource

The maps in this submission include: heat flow, alkalinity, Cl, Mg, SiO2, Quaternary volcanic rocks, faults, and land ownership. All of the Oregon Cascade region. The work was done by John Trimble, in 2015, at Oregon State University.

0
No licence known
Tags:
ChlorideClConcentrationFaultsFelsicMaficMagnesiumMgQuaternarySiO2SilicaVolcanicsalkalinitycascadesfaultflowgeochemistrygeothermalheatheatflowhotkriginglandlocationsmaporegonownershipsamplesilicatesprings
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Oregon Cascades Play Fairway Analysis: Raster Datasets and ModelsSource

This submission includes maps of the spatial distribution of basaltic, and felsic rocks in the Oregon Cascades. It also includes a final Play Fairway Analysis (PFA) model, with the heat and permeability composite risk segments (CRS) supplied separately. Metadata for each raster dataset can be found within the zip files, in the TIF images

0
No licence known
Tags:
ArcGISGISOregonOregon Cascadesbasaltcascadescomposite risk segmentcrsfelsicfelsic rocksgeologygeospatial datageothermalheatheat composite risk segmentmaficmafic rocksmodelpermeabilitypfaplay fairway analysisrhyolite
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Play Fairway Analysis CA-NV-OR: Additional 2km Grid FiguresSource

Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area. Grids at 2km, updated from 5km.

0
No licence known
Tags:
CA-NV-ORCaliforniaMedicine LakeNevadaOregonPFASan Emidiocharacterizationdata differencedegree of explorationexplorationgeologic profilegeoreferencedgeospatial datageothermalheatheat flowjpegpermeabilityplay fairway analysisrankraster
Formats:
JPEGHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
Play Fairway Analysis CA-NV-OR: Figures on 2km GridsSource

Various data sets displayed on a 2km grid for the Play Fairway Analysis CA-NV-OR area.

0
No licence known
Tags:
CA-NV-ORCaliforniaNevadaOregoncharacterizationexplorationfavorabilitygeochemistrygeologic profilegeophysicsgeoreferencedgeospatial datageothermalheatheat flowheat rankland accesspermeabilitypfaplay fairway analysisprotected landquantity of datarankrasterseismicseismic momentskewstructural
Formats:
JPEG
National Renewable Energy Laboratory (NREL)over 1 year ago
Snake River Plain Geothermal Play Fairway Analysis Heat, Permeability, and Seal CRS Map Raster FilesSource

Snake River Plain Play Fairway Analysis - Phase 1 CRS Raster Files. This dataset contains raster files created in ArcGIS. These raster images depict Common Risk Segment (CRS) maps for HEAT, PERMEABILITY, AND SEAL, as well as selected maps of Evidence Layers. These evidence layers consist of either Bayesian krige functions or kernel density functions, and include: (1) HEAT: Heat flow (Bayesian krige map), Heat flow standard error on the krige function (data confidence), volcanic vent distribution as function of age and size, groundwater temperature (equivalue interval and natural breaks bins), and groundwater T standard error. (2) PERMEABILTY: Fault and lineament maps, both as mapped and as kernel density functions, processed for both dilational tendency (TD) and slip tendency (ST), along with data confidence maps for each data type. Data types include mapped surface faults from USGS and Idaho Geological Survey data bases, as well as unpublished mapping; lineations derived from maximum gradients in magnetic, deep gravity, and intermediate depth gravity anomalies. (3) SEAL: Seal maps based on presence and thickness of lacustrine sediments and base of SRP aquifer. Raster size is 2 km. All files generated in ArcGIS.

0
No licence known
Tags:
IdahoPlay Fairway AnalysisSnake River Plainaquiferdilation tendancyfaultingfaultsgeothermalgravitygroundwater temperatureheatheat sourcemagneticpermeabilitypfaresource assessmentsealsedimentsite characterizationslip tendancysrpvent
Formats:
PNG
National Renewable Energy Laboratory (NREL)over 1 year ago
The non-gas mapSource

The non-gas map is a detailed map of Great Britain showing the distribution of properties without a gas grid connection across local authorities, LSOAs (lower-level super output areas) and, for registered users, postcodes. For each region, the map displays: Distances from gas grid; Central heating energy source; Energy efficiency measures; Property type; Tenure; Number of rooms; Energy performance rating (EPC)

0
License not specified
Tags:
UKbuildingbuilt environmentenergygasheatmapscotlandtool
Formats:
HTML
Affordable Warmth Solutions CICabout 1 year ago
Tularosa Basin Play Fairway Analysis Data and ModelsSource

This submission includes raster datasets for each layer of evidence used for weights of evidence analysis as well as the deterministic play fairway analysis (PFA). Data representative of heat, permeability and groundwater comprises some of the raster datasets. Additionally, the final deterministic PFA model is provided along with a certainty model. All of these datasets are best used with an ArcGIS software package, specifically Spatial Data Modeler.

0
No licence known
Tags:
ArcGISGISGIS layerenergyexplorationgeospatial datageothermalgroundwaterheatmodelnew mexicopermeabilitypfaplay fairway analysisprobabilityrasterresource assessmentshapefiletularosatularosa basinweights of evidence
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Tularosa Basin Play Fairway Analysis ModelSource

This submission contains several shapefiles used for a deterministic PFA, as well as a heat composite risk segment with union overlay, and training sites used for weights of evidence. More detailed metadata can be found in the specific file.

0
No licence known
Tags:
ArcGISFairwayGISPlayanalysisbasincertaintycompositecrsdissolvefort blissgeospatial datageothermalheatheat crsmcgregor rangenew mexicopfaplay fairway analysisrisksegmentshape fileshapefilesitestrainingtularosaunionweights of evidence
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
Tularosa Basin Play Fairway Analysis: Groundwater, Heat Flow, Relief MapSource

In this submission is the groundwater composite risk segment (CRS) used for play fairway analysis. Also included is a heat flow probability map, and a shaded relief map of the Tularosa Basin, NM.

0
No licence known
Tags:
ArcGISGISbasincomposite risk segmentcrsflowfort blissgeospatial datageothermalgroundwaterheatheatflowmapmcgregor rangemexiconewnew mexicopfaplay fairway analysisprobabilityreliefshadedshaded reliefshape fileshapefiletularosa
Formats:
ZIPHTML
National Renewable Energy Laboratory (NREL)over 1 year ago
UNSATCHEM

UNSATCHEM is a software package for simulating water, heat, carbon dioxide and solute movement in one-dimensional variably saturated media. The software consists of the UNSCHEM (version 2.0) computer program, and the UNSATCH interactive graphics-based user interface. The UNSCHEM program numerically solves the Richards' equation for variably-saturated water flow and convection-dispersion type equations for heat, carbon dioxide and solute transport. The flow equation incorporates a sink term to account for water uptake by plant roots. The heat transport equation considers transport due to conduction and convection with flowing water. Diffusion in both liquid and gas phases and convection in the liquid phase are considered as CO2 transport mechanisms. The CO2 production model is described. The major variables of the chemical system are Ca, Mg, Na, K, SO4, Cl, NO3, H4SiO4, alkalinity, and CO2. The model accounts for equilibrium chemical reactions between these components such as complexation, cation exchange and precipitation-dissolution. For the precipitation-dissolution of calcite and dissolution of dolomite, either equilibrium or multicomponent kinetic expressions are used which include both forward and back reactions. Other dissolution-precipitation reactions considered include gypsum, hydromagnesite, nesquehonite, and sepiolite. Since the ionic strength of soil solutions can vary considerably with time and space and often reach high values, both modified Debye-Huckel and Pitzer expressions were incorporated into the model as options to calculate single ion activities. The program may be used to analyze water and solute movement in unsaturated, partially saturated, or fully saturated porous media. The flow region may be composed of nonuniform soils. Flow and transport can occur in the vertical, horizontal, or a generally inclined direction. The water flow part of the model can deal with prescribed head and flux boundaries, boundaries controlled by atmospheric conditions, as well as free drainage boundary conditions. The governing flow and transport equations are solved numerically using finite differences and Galerkin-type linear finite element schemes, respectively. This report serves as both a user manual and reference document. Detailed instructions are given for data input preparation. A graphics-based user interface, UNSATCH, for data preparation and graphical output display in the MS Windows environment is described in the second part of the manual.

0
No licence known
Tags:
FlowWatercarbon dioxideheatmodelsolute movementwater saturation
Formats:
HTML
United States Department of Agriculture10 months ago
USDA Agricultural Research Service- Patented Materials and Methods Technologies

Patented technologies on materials and methods that are available for licensing. Updated June 2018.

0
No licence known
Tags:
acidanimalscompositesglyceridesheatnanoparticlesplants
Formats:
PPTXCSV
United States Department of Agriculture10 months ago
Understanding Constraints on Geothermal Sustainability Through Reservoir Characterization at Brady Geothermal Field, NevadaSource

The vast supply of geothermal energy stored throughout the Earth and the exceedingly long time required to dissipate that energy makes the world's geothermal energy supply nearly limitless. As such, this resource holds the potential to provide a large supply of the world's energy demands; however, like all natural resources, it must be utilized in an appropriate manner if it is to be sustainable. Understanding sustainable use of geothermal resources requires thorough characterization efforts aimed at better understanding subsurface properties. The goal of this work is to understand which critical subsurface properties exert the most influence on sustainable geothermal production as a means to provide targeted future resource characterization strategies. Borehole temperature and reservoir pressure data were analyzed to estimate reservoir thermal and hydraulic properties at an active geothermal site. These reservoir properties then served as inputs for an analytical model which simulated net power production over a 30-year period. The analytical model was used to conduct a sensitivity analysis to determine which parameters were most critical in constraining the sustainability of a geothermal reservoir. Modeling results reveal that the number of preferential flow pathways (i.e. fractures) used for heat transport provides the greatest impact on geothermal reservoir sustainability. These results suggest that early and pre-production geothermal reservoir exploration would achieve the greatest benefit from characterization strategies which seek to delineate the number of active flow pathways present in the system.

0
No licence known
Tags:
Brady Hot SpringsDTSNevadaPoroTomoanalysisanalyticalassessmentborehole pressureborehole temperaturecharacterizationdistributed temperature sensingenergyflowflow pathsfracturesgeothermalheathydraulichydrogeologyidentificationmodelnumericalparameterspathwayspower productionpreferentialpressureproductionpropertiesreservoirreservoir characterizationresorcesensitivitysimulationsubsurface propertiessustainabilitysustainable usetemperaturethermaltransport
Formats:
PDF
National Renewable Energy Laboratory (NREL)over 1 year ago
Utah FORGE: Heat Flow Contours and Well DataSource

This submission contains a shapefile of heat flow contour lines around the FORGE site located in Milford, Utah. The model was interpolated from data points in the Milford_wells shapefile. This heat flow model was interpolated from 66 data points using the kriging method in Geostatistical Analyst tool of ArcGIS. The resulting model was smoothed 100%. The well dataset contains 59 wells from various sources, with lat/long coordinates, temperature, quality, basement depth, and heat flow. This data was used to make models of the specific characteristics.

0
No licence known
Tags:
ArcGISEGSFORGEMilfordRoosevelt Hot SpringsUtah FORGEbasementcharacterizationcontourdatadepthflowgeospatial datageostatisticsgeothermalheatheat flowheatflowmodelingprocessed dataresourceshape fileshapefileutahwell datawells
Formats:
ZIP
National Renewable Energy Laboratory (NREL)over 1 year ago
VT Data - Heat Vulnerability IndexSource

Explore this data in a series of maps here. The Vermont Heat Vulnerability Index draws together 17 different measures of vulnerability in six different themes: population, socioeconomic, health, environmental, climate, and heat illness. These measures are combined to measure the overall vulnerability of Vermont towns to heat-related events. This is a first step to identify populations that may be more vulnerable to extreme heat, however local knowledge should always be considered when it is available.Analytical and mapping methods are described in further detail in the Vermont Heat Vulnerability Assessment ReportData last updated 2016.Measures:Heat Vulnerability Measures Population Characteristics: 1. % population less than 5 years old 2. % population 65 years old or older Socioeconomic Characteristics: 3. % population living below Federal Poverty Line 4. % adult population with no high school diploma 5. % adults 65 and older living alone 6. % adult population with no health insurance Health Conditions: 7. % adults with diabetes 8. % adults with asthma 9. % adults with hypertension 10. % adults who are obese 11. % adults in fair or poor health 12. All-cause mortality, warm season deaths Environmental Characteristics: 13. Housing units per square mile 14. % covered with Impervious surface 15. % covered by forest canopy Climate Characteristics: 16. Average number of days per year 87° F or hotter Observed Heat Illness: 17. Heat-related emergency department visits

0
No licence known
Tags:
Heat Vulnerability Indexextreme heatheat
Formats:
HTMLArcGIS GeoServices REST APICSVGeoJSONZIPKML
State of Vermont12 months ago
Washington Play Fairway Analysis Geothermal Heat and Permeability Potential GeodatabasesSource

This file contains file geodatabases of the Mount St. Helens seismic zone (MSHSZ), Wind River valley (WRV) and Mount Baker (MB) geothermal play-fairway sites in the Washington Cascades. The geodatabases include input data (feature classes) and output rasters (generated from modeling and interpolation) from the geothermal play-fairway in Washington State, USA. These data were gathered and modeled to provide an estimate of the heat and permeability potential within the play-fairways based on: mapped volcanic vents, hot springs and fumaroles, geothermometry, intrusive rocks, temperature-gradient wells, slip tendency, dilation tendency, displacement, displacement gradient, max coulomb shear stress, sigma 3, maximum shear strain rate, and dilational strain rate at 200m and 3 km depth. In addition this file contains layer files for each of the output rasters. For details on the areas of interest please see the 'Phase 1 Technical Report' in the download package. This submission also includes a file with the geothermal favorability of the Washington Cascade Range based off of an earlier statewide assessment. Additionally, within this file there are the maximum shear and dilational strain rate rasters for all of Washington State.

0
No licence known
Tags:
ArcGISCascade RangeGISGeothermal favorabilityMount BakerMount St. Helens seismic zoneSlip tendencyStrain rateWashingtonWind River valleydilation tendencydilational strain ratedisplacementdisplacement gradientfaultfavorabilityfumarolegdbgeodatabasegeospatial datageothermalgeothermometryheathot springintrusive rockmaximum Coulomb shear stressmaximum shear strain ratepermeabilitypfaplay-fairwayrisksensitivitysigma 3temeprature gradientuncertaintyvolcanic ventwashington state
Formats:
ZIPPDF
National Renewable Energy Laboratory (NREL)over 1 year ago