L o a d i n g
Organization
US Department of Transportation - view all
Update frequencyunknown
Last updatedabout 2 years ago
Format
Overviewconditionextenthighwayshpmsmapmileageperformancetraveluse
The Highway Performance Monitoring System (HPMS) compiles data on highway network extent, use, condition, and performance. The system consists of a geospatially‐enabled database that is used to generate reports and provides tools for data analysis. Information from HPMS is used by many stakeholders across the US DOT, the Administration, Congress, and the transportation community.
Additional Information
KeyValue
Categories{transportation,finance}
Common Core Bureau Code021:15
Common Core Contact EmailThomas.Roff@dot.gov
Common Core Contact NameThomas Roff
Common Core Data Standardhttps://www.fhwa.dot.gov/policyinformation/hpms/fieldmanual/
Common Core Homepagehttps://www.fhwa.dot.gov/policyinformation/hpms.cfm
Common Core Is Quality DataTrue
Common Core LanguageEnglish
Common Core Licensehttps://creativecommons.org/publicdomain/zero/1.0/
Common Core Program Code021:009
Common Core Public Access Levelpublic
Common Core PublisherFederal Highway Administration
Common Core System Of RecordsHighway Performance Monitoring System (HPMS)
Common Core Update Frequency Annual
LicensePublic Domain U.S. Government
Owner Display NameWinter, David (FHWA)
Source Created At2019-05-01T17:22:55.000Z
Source Updated At2019-06-18T20:04:48.000Z
